PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G241300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 287aa    MW: 32379.9 Da    PI: 6.1047
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G241300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.7e-201663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT++Ed+llv++v+q+G g+W+++a+  g++R++k+c++rw +yl
  Sevir.1G241300.1.p 16 KGPWTAQEDKLLVEYVRQHGEGRWNSVAKLTGLKRSGKSCRLRWVNYL 63
                        79********************************************97 PP

2Myb_DNA-binding50.93.5e-1669113147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Sevir.1G241300.1.p  69 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                         8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6521163IPR017930Myb domain
SuperFamilySSF466891.76E-3014110IPR009057Homeodomain-like
SMARTSM007174.0E-171565IPR001005SANT/Myb domain
PfamPF002499.0E-191663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-241770IPR009057Homeodomain-like
CDDcd001673.21E-121863No hitNo description
PROSITE profilePS5129424.93364118IPR017930Myb domain
SMARTSM007174.5E-1568116IPR001005SANT/Myb domain
PfamPF002496.2E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2471116IPR009057Homeodomain-like
CDDcd001671.76E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEGQFGWGRE EGGWRKGPWT AQEDKLLVEY VRQHGEGRWN SVAKLTGLKR SGKSCRLRWV  60
NYLRPDLKRG KITPQEESVI LELHALWGNR WSTIARSLPG RTDNEIKNYW RTHFKKGKPS  120
KNIERARARF LKQRREMQSQ LLLQQQGQDQ QHHQQQRQAG NDHDDEAVVR EEASSPAVSL  180
AAQQHEEDLR MLQQDMDDLL FQFCPMIASC TSSSCGLLPG AATASASATA SDEGSSGDHQ  240
LDGAAATWGW GSLWNLDDVV DDIVDGGWDW DTSSYPLLQD QGLAFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26161167106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-147AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-147AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953122.10.0PREDICTED: protein ODORANT1-like
TrEMBLK3YUR10.0K3YUR1_SETIT; Uncharacterized protein
STRINGSi018007m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-65myb domain protein 79